Print Friendly, PDF & Email


CDX2, 1C7

Catalogue number: CDX002

Clone1C7
IsotypeIgG mix kappa
Units1 ml
HostMouse
Application IHC(C
P)

Background
The antibody against CDX2 is well suited for the detection of the product in cell nuclei and in tissue extracts. CDX2 is a homeobox-gen encoding for an intestinal transcription factor, which is exprimed by nuclei of intestinal epithelial cells especially in the rectum and duodenum. It is over-expressed in colorectal carcinoma and related metastases. It was also identified in metaplasia of the stomach and in carcinoma of the gut. CDX2 is not produced by normal mucous membranes of the stomach. CDX2, human.

Source

Immunogen: Recombinant human CDX2 AS 1-314 with GST-Tag. MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQ

Product
Purified IgG in PBS, pH 7.2, 0,09% sodium azide

Purification Method: Purified IgG in PBS, pH 7.2, 0,09% sodium azide

Concentration: 50 µg/ml

Secondary Reagents: We recommend the use of BIOLOGO's Universal Staining System DAB (Art. No. DA005) or AEC (Art.-No. AE005).

Specificity

Species Reactivity: Human, others not tested

Applications
IHC(C, P)

Incubation Time: 60 min at RT

Working Concentration: (liquid conc.) 3 µg/ml

Pre-Treatment: Formalin-fixed tissue requires antigen unmasking in citrate buffer pH 6 (Art. No. DE000) 15-30 min at 100°C. Blocking of endogenous oxido-reductases with H2O2 1% 30 min., blocking of non-specific protein binding with SeaBlock (Art. No. PU083).

Positive Control: Colon carcinoma

Storage
2-8°C

Caution
*These antibodies are intended for in vitro research use only. They must not be used for clinical diagnostics and not for in vivo experiments in humans or animals. ** The preservative sodium azide is known to be poisonous and potentially hazardous to health. It should be handled only by trained staff. Despite of the product's low azide concentration it must be handled with care. Dispose according to regional rules!

References
1. Barbareschi M., Murer B., Colby T.V., Chilosi M., Macri E., Loda M., Coglioni C. (2003) CDX-2 homeobox gene expression is a reliable marker of colorectal adenocarcinoma metastases to the lungs. Am J. Surg. Pathol. 27; 141-149 2. Werling R.W. Yaziji H., Bacchi C.E., Gown A.M. (2003) CDX2, a highly sensitive and specific marker of adenocarcinomas of intestinal origin: An immunohistochemical survey of 476 primary and metastatic carcinomas. Am. J. Surg. Pathol. 27; 303-310.


CDX2, 1C7

$580.00

SKU: CDX002 Categories: ,

Brand

Contact us

Exalpha Biologicals, Inc.
2 Shaker Road, Unit B101
Shirley, MA 01464
Phone: 978-425-1370
Email: info@exalpha.com

Member

Newsletter