Print Friendly, PDF & Email


RNF31 (ring finger protein 31)

Catalogue number: RNF031

Units50 µg
HostRabbit
Application Western Blotting

Background
Murine RNF31-protein.

Source

Immunogen: GX0797 (GST-fusion protein, 157 amino acids): CKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRVMEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATIRYLHLAQPADGEDLPAYQARLLQKLREEVPLGQSIARRRK

Product
Affinity purified antibody in PBS with 50 % glycerol and 0.02 % NaN3**

Purification Method: Affinity purified antibody in PBS with 50 % glycerol and 0.02 % NaN3**

Concentration: 50 µg / 250 µl

Specificity

Species Reactivity: Mouse, other species not tested

Applications
WB

Incubation Time: WB (1:1000), other applications not tested

Working Concentration: (liquid conc.) 1:1000 (WB)

Storage
-20°C

Caution
*These antibodies are intended for in vitro research use only. They must not be used for clinical diagnostics and not for in vivo experiments in humans or animals. ** The preservative sodium azide is known to be poisonous and potentially hazardous to health. It should be handled only by trained staff. Despite of the product's low azide concentration it must be handled with care. Dispose according to regional rules!

References
Okazaki, N. et al.: Prediction of the Coding Sequences of Mouse Homologues of KIAA Gene: II. The Complete Nucleotide Sequences of 400 Mouse KIAA-homologous cDNAs Identified by Screening of Terminal Sequences of cDNA Clones Randomly Sampled from Size-fractionated Libraries. DNA Res., 10(1), 35 (2003).


RNF31 (ring finger protein 31)

$1,113.00

SKU: RNF031 Categories: ,

Brand

Contact us

Exalpha Biologicals, Inc.
2 Shaker Road, Unit B101
Shirley, MA 01464
Phone: 978-425-1370
Email: info@exalpha.com

Member

Newsletter